Anti GLYCTK pAb (ATL-HPA006913)

Atlas Antibodies

SKU:
ATL-HPA006913-100
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: glycerate kinase
Gene Name: GLYCTK
Alternative Gene Name: HBEBP2, HBEBP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020258: 94%, ENSRNOG00000046307: 94%
Entrez Gene ID: 132158
Uniprot ID: Q8IVS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen IRAAMERAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVG
Gene Sequence IRAAMERAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVG
Gene ID - Mouse ENSMUSG00000020258
Gene ID - Rat ENSRNOG00000046307
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLYCTK pAb (ATL-HPA006913)
Datasheet Anti GLYCTK pAb (ATL-HPA006913) Datasheet (External Link)
Vendor Page Anti GLYCTK pAb (ATL-HPA006913) at Atlas Antibodies

Documents & Links for Anti GLYCTK pAb (ATL-HPA006913)
Datasheet Anti GLYCTK pAb (ATL-HPA006913) Datasheet (External Link)
Vendor Page Anti GLYCTK pAb (ATL-HPA006913)