Anti GLYAT pAb (ATL-HPA040251 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040251-100
  • Immunohistochemistry analysis in human kidney and skeletal muscle tissues using Anti-GLYAT antibody. Corresponding GLYAT RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: glycine-N-acyltransferase
Gene Name: GLYAT
Alternative Gene Name: ACGNAT, GAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063683: 66%, ENSRNOG00000012142: 68%
Entrez Gene ID: 10249
Uniprot ID: Q6IB77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQHVPIPRSWNQWNCVPL
Gene Sequence DQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQHVPIPRSWNQWNCVPL
Gene ID - Mouse ENSMUSG00000063683
Gene ID - Rat ENSRNOG00000012142
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLYAT pAb (ATL-HPA040251 w/enhanced validation)
Datasheet Anti GLYAT pAb (ATL-HPA040251 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLYAT pAb (ATL-HPA040251 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GLYAT pAb (ATL-HPA040251 w/enhanced validation)
Datasheet Anti GLYAT pAb (ATL-HPA040251 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLYAT pAb (ATL-HPA040251 w/enhanced validation)