Anti GLUD1 pAb (ATL-HPA061369)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061369-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GLUD1
Alternative Gene Name: GDH, GLUD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021794: 100%, ENSRNOG00000057367: 99%
Entrez Gene ID: 2746
Uniprot ID: P00367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDK |
| Gene Sequence | DMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDK |
| Gene ID - Mouse | ENSMUSG00000021794 |
| Gene ID - Rat | ENSRNOG00000057367 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GLUD1 pAb (ATL-HPA061369) | |
| Datasheet | Anti GLUD1 pAb (ATL-HPA061369) Datasheet (External Link) |
| Vendor Page | Anti GLUD1 pAb (ATL-HPA061369) at Atlas Antibodies |
| Documents & Links for Anti GLUD1 pAb (ATL-HPA061369) | |
| Datasheet | Anti GLUD1 pAb (ATL-HPA061369) Datasheet (External Link) |
| Vendor Page | Anti GLUD1 pAb (ATL-HPA061369) |
| Citations for Anti GLUD1 pAb (ATL-HPA061369) – 1 Found |
| Zhao, Xiao; Karpac, Jason. Glutamate metabolism directs energetic trade-offs to shape host-pathogen susceptibility in Drosophila. Cell Metabolism. 2021;33(12):2428-2444.e8. PubMed |