Anti GLUD1 pAb (ATL-HPA044839)

Atlas Antibodies

Catalog No.:
ATL-HPA044839-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: glutamate dehydrogenase 1
Gene Name: GLUD1
Alternative Gene Name: GDH, GLUD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021794: 96%, ENSRNOG00000057367: 96%
Entrez Gene ID: 2746
Uniprot ID: P00367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSIL
Gene Sequence TFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSIL
Gene ID - Mouse ENSMUSG00000021794
Gene ID - Rat ENSRNOG00000057367
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLUD1 pAb (ATL-HPA044839)
Datasheet Anti GLUD1 pAb (ATL-HPA044839) Datasheet (External Link)
Vendor Page Anti GLUD1 pAb (ATL-HPA044839) at Atlas Antibodies

Documents & Links for Anti GLUD1 pAb (ATL-HPA044839)
Datasheet Anti GLUD1 pAb (ATL-HPA044839) Datasheet (External Link)
Vendor Page Anti GLUD1 pAb (ATL-HPA044839)