Anti GLUD1 pAb (ATL-HPA044839)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044839-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GLUD1
Alternative Gene Name: GDH, GLUD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021794: 96%, ENSRNOG00000057367: 96%
Entrez Gene ID: 2746
Uniprot ID: P00367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSIL |
| Gene Sequence | TFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSIL |
| Gene ID - Mouse | ENSMUSG00000021794 |
| Gene ID - Rat | ENSRNOG00000057367 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GLUD1 pAb (ATL-HPA044839) | |
| Datasheet | Anti GLUD1 pAb (ATL-HPA044839) Datasheet (External Link) |
| Vendor Page | Anti GLUD1 pAb (ATL-HPA044839) at Atlas Antibodies |
| Documents & Links for Anti GLUD1 pAb (ATL-HPA044839) | |
| Datasheet | Anti GLUD1 pAb (ATL-HPA044839) Datasheet (External Link) |
| Vendor Page | Anti GLUD1 pAb (ATL-HPA044839) |