Anti GLUD1 pAb (ATL-HPA044839)

Atlas Antibodies

Catalog No.: ATL-HPA044839-25

Protein Description: glutamate dehydrogenase 1
Gene Name: GLUD1
Alternative Gene Name: GDH, GLUD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021794: 96%, ENSRNOG00000057367: 96%
Entrez Gene ID: 2746
Uniprot ID: P00367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSIL
• Gene Sequence: TFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSIL
• Gene ID - Mouse: ENSMUSG00000021794
• Gene ID - Rat: ENSRNOG00000057367
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.