Anti GLTSCR2 pAb (ATL-HPA049600)

Atlas Antibodies

Catalog No.:
ATL-HPA049600-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: glioma tumor suppressor candidate region gene 2
Gene Name: GLTSCR2
Alternative Gene Name: PICT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041560: 80%, ENSRNOG00000013023: 80%
Entrez Gene ID: 29997
Uniprot ID: Q9NZM5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFFVDTGSKEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKEQLWEKLA
Gene Sequence LFFVDTGSKEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKEQLWEKLA
Gene ID - Mouse ENSMUSG00000041560
Gene ID - Rat ENSRNOG00000013023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLTSCR2 pAb (ATL-HPA049600)
Datasheet Anti GLTSCR2 pAb (ATL-HPA049600) Datasheet (External Link)
Vendor Page Anti GLTSCR2 pAb (ATL-HPA049600) at Atlas Antibodies

Documents & Links for Anti GLTSCR2 pAb (ATL-HPA049600)
Datasheet Anti GLTSCR2 pAb (ATL-HPA049600) Datasheet (External Link)
Vendor Page Anti GLTSCR2 pAb (ATL-HPA049600)