Anti GLTSCR2 pAb (ATL-HPA049600)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049600-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GLTSCR2
Alternative Gene Name: PICT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041560: 80%, ENSRNOG00000013023: 80%
Entrez Gene ID: 29997
Uniprot ID: Q9NZM5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LFFVDTGSKEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKEQLWEKLA |
| Gene Sequence | LFFVDTGSKEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKEQLWEKLA |
| Gene ID - Mouse | ENSMUSG00000041560 |
| Gene ID - Rat | ENSRNOG00000013023 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GLTSCR2 pAb (ATL-HPA049600) | |
| Datasheet | Anti GLTSCR2 pAb (ATL-HPA049600) Datasheet (External Link) |
| Vendor Page | Anti GLTSCR2 pAb (ATL-HPA049600) at Atlas Antibodies |
| Documents & Links for Anti GLTSCR2 pAb (ATL-HPA049600) | |
| Datasheet | Anti GLTSCR2 pAb (ATL-HPA049600) Datasheet (External Link) |
| Vendor Page | Anti GLTSCR2 pAb (ATL-HPA049600) |