Anti GLTSCR2 pAb (ATL-HPA049600)

Atlas Antibodies

Catalog No.: ATL-HPA049600-25

Protein Description: glioma tumor suppressor candidate region gene 2
Gene Name: GLTSCR2
Alternative Gene Name: PICT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041560: 80%, ENSRNOG00000013023: 80%
Entrez Gene ID: 29997
Uniprot ID: Q9NZM5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFFVDTGSKEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKEQLWEKLA
• Gene Sequence: LFFVDTGSKEKGLTKKRTKVQKKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKEQLWEKLA
• Gene ID - Mouse: ENSMUSG00000041560
• Gene ID - Rat: ENSRNOG00000013023
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.