Anti GLTSCR2 pAb (ATL-HPA018999)

Atlas Antibodies

Catalog No.:
ATL-HPA018999-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glioma tumor suppressor candidate region gene 2
Gene Name: GLTSCR2
Alternative Gene Name: PICT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041560: 93%, ENSRNOG00000013023: 95%
Entrez Gene ID: 29997
Uniprot ID: Q9NZM5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REAEADKPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL
Gene Sequence REAEADKPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL
Gene ID - Mouse ENSMUSG00000041560
Gene ID - Rat ENSRNOG00000013023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLTSCR2 pAb (ATL-HPA018999)
Datasheet Anti GLTSCR2 pAb (ATL-HPA018999) Datasheet (External Link)
Vendor Page Anti GLTSCR2 pAb (ATL-HPA018999) at Atlas Antibodies

Documents & Links for Anti GLTSCR2 pAb (ATL-HPA018999)
Datasheet Anti GLTSCR2 pAb (ATL-HPA018999) Datasheet (External Link)
Vendor Page Anti GLTSCR2 pAb (ATL-HPA018999)
Citations for Anti GLTSCR2 pAb (ATL-HPA018999) – 1 Found
Okamura, Kyoko; Takayama, Koichi; Kawahara, Kohichi; Harada, Taishi; Nishio, Miki; Otsubo, Kohei; Ijichi, Kayo; Kohno, Mikihiro; Iwama, Eiji; Fujii, Akiko; Ota, Keiichi; Koga, Takaomi; Okamoto, Tatsuro; Suzuki, Akira; Nakanishi, Yoichi. PICT1 expression is a poor prognostic factor in non-small cell lung cancer. Oncoscience. 1(5):375-82.  PubMed