Anti GLTSCR1 pAb (ATL-HPA056211)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056211-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GLTSCR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070808: 89%, ENSRNOG00000011262: 89%
Entrez Gene ID: 29998
Uniprot ID: Q9NZM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTALDPVHQPPPPPATLKVA |
Gene Sequence | ASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTALDPVHQPPPPPATLKVA |
Gene ID - Mouse | ENSMUSG00000070808 |
Gene ID - Rat | ENSRNOG00000011262 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GLTSCR1 pAb (ATL-HPA056211) | |
Datasheet | Anti GLTSCR1 pAb (ATL-HPA056211) Datasheet (External Link) |
Vendor Page | Anti GLTSCR1 pAb (ATL-HPA056211) at Atlas Antibodies |
Documents & Links for Anti GLTSCR1 pAb (ATL-HPA056211) | |
Datasheet | Anti GLTSCR1 pAb (ATL-HPA056211) Datasheet (External Link) |
Vendor Page | Anti GLTSCR1 pAb (ATL-HPA056211) |