Anti GLTSCR1 pAb (ATL-HPA056211)

Atlas Antibodies

Catalog No.: ATL-HPA056211-25

Protein Description: glioma tumor suppressor candidate region gene 1
Gene Name: GLTSCR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070808: 89%, ENSRNOG00000011262: 89%
Entrez Gene ID: 29998
Uniprot ID: Q9NZM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTALDPVHQPPPPPATLKVA
• Gene Sequence: ASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTALDPVHQPPPPPATLKVA
• Gene ID - Mouse: ENSMUSG00000070808
• Gene ID - Rat: ENSRNOG00000011262
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.