Anti GLTP pAb (ATL-HPA065503)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065503-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GLTP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011884: 95%, ENSRNOG00000001192: 95%
Entrez Gene ID: 51228
Uniprot ID: Q9NZD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYA |
Gene Sequence | RGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYA |
Gene ID - Mouse | ENSMUSG00000011884 |
Gene ID - Rat | ENSRNOG00000001192 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GLTP pAb (ATL-HPA065503) | |
Datasheet | Anti GLTP pAb (ATL-HPA065503) Datasheet (External Link) |
Vendor Page | Anti GLTP pAb (ATL-HPA065503) at Atlas Antibodies |
Documents & Links for Anti GLTP pAb (ATL-HPA065503) | |
Datasheet | Anti GLTP pAb (ATL-HPA065503) Datasheet (External Link) |
Vendor Page | Anti GLTP pAb (ATL-HPA065503) |