Anti GLTP pAb (ATL-HPA056461 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA056461-25

• 
• 
• 

Protein Description: glycolipid transfer protein
Gene Name: GLTP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011884: 96%, ENSRNOG00000001192: 96%
Entrez Gene ID: 51228
Uniprot ID: Q9NZD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISG
• Gene Sequence: ALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISG
• Gene ID - Mouse: ENSMUSG00000011884
• Gene ID - Rat: ENSRNOG00000001192
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.