Anti GLTP pAb (ATL-HPA056461 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA056461-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glycolipid transfer protein
Gene Name: GLTP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011884: 96%, ENSRNOG00000001192: 96%
Entrez Gene ID: 51228
Uniprot ID: Q9NZD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISG
Gene Sequence ALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISG
Gene ID - Mouse ENSMUSG00000011884
Gene ID - Rat ENSRNOG00000001192
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLTP pAb (ATL-HPA056461 w/enhanced validation)
Datasheet Anti GLTP pAb (ATL-HPA056461 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLTP pAb (ATL-HPA056461 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GLTP pAb (ATL-HPA056461 w/enhanced validation)
Datasheet Anti GLTP pAb (ATL-HPA056461 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLTP pAb (ATL-HPA056461 w/enhanced validation)