Anti GLT8D2 pAb (ATL-HPA070791)
Atlas Antibodies
- SKU:
- ATL-HPA070791-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GLT8D2
Alternative Gene Name: FLJ31494
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020251: 95%, ENSRNOG00000033579: 92%
Entrez Gene ID: 83468
Uniprot ID: Q9H1C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRFYLPLLIHQHEKVIYLDD |
Gene Sequence | TRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRFYLPLLIHQHEKVIYLDD |
Gene ID - Mouse | ENSMUSG00000020251 |
Gene ID - Rat | ENSRNOG00000033579 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GLT8D2 pAb (ATL-HPA070791) | |
Datasheet | Anti GLT8D2 pAb (ATL-HPA070791) Datasheet (External Link) |
Vendor Page | Anti GLT8D2 pAb (ATL-HPA070791) at Atlas Antibodies |
Documents & Links for Anti GLT8D2 pAb (ATL-HPA070791) | |
Datasheet | Anti GLT8D2 pAb (ATL-HPA070791) Datasheet (External Link) |
Vendor Page | Anti GLT8D2 pAb (ATL-HPA070791) |