Anti GLT8D2 pAb (ATL-HPA070791)

Atlas Antibodies

Catalog No.: ATL-HPA070791-25

Protein Description: glycosyltransferase 8 domain containing 2
Gene Name: GLT8D2
Alternative Gene Name: FLJ31494
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020251: 95%, ENSRNOG00000033579: 92%
Entrez Gene ID: 83468
Uniprot ID: Q9H1C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRFYLPLLIHQHEKVIYLDD
• Gene Sequence: TRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRFYLPLLIHQHEKVIYLDD
• Gene ID - Mouse: ENSMUSG00000020251
• Gene ID - Rat: ENSRNOG00000033579
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.