Anti GLT8D2 pAb (ATL-HPA070791)

Atlas Antibodies

SKU:
ATL-HPA070791-25
  • Immunofluorescent staining of human cell line SiHa shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glycosyltransferase 8 domain containing 2
Gene Name: GLT8D2
Alternative Gene Name: FLJ31494
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020251: 95%, ENSRNOG00000033579: 92%
Entrez Gene ID: 83468
Uniprot ID: Q9H1C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRFYLPLLIHQHEKVIYLDD
Gene Sequence TRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRFYLPLLIHQHEKVIYLDD
Gene ID - Mouse ENSMUSG00000020251
Gene ID - Rat ENSRNOG00000033579
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLT8D2 pAb (ATL-HPA070791)
Datasheet Anti GLT8D2 pAb (ATL-HPA070791) Datasheet (External Link)
Vendor Page Anti GLT8D2 pAb (ATL-HPA070791) at Atlas Antibodies

Documents & Links for Anti GLT8D2 pAb (ATL-HPA070791)
Datasheet Anti GLT8D2 pAb (ATL-HPA070791) Datasheet (External Link)
Vendor Page Anti GLT8D2 pAb (ATL-HPA070791)