Anti GLRX2 pAb (ATL-HPA057224)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057224-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GLRX2
Alternative Gene Name: bA101E13.1, GRX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018196: 73%, ENSRNOG00000003385: 73%
Entrez Gene ID: 51022
Uniprot ID: Q9NS18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMA |
| Gene Sequence | AAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMA |
| Gene ID - Mouse | ENSMUSG00000018196 |
| Gene ID - Rat | ENSRNOG00000003385 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GLRX2 pAb (ATL-HPA057224) | |
| Datasheet | Anti GLRX2 pAb (ATL-HPA057224) Datasheet (External Link) |
| Vendor Page | Anti GLRX2 pAb (ATL-HPA057224) at Atlas Antibodies |
| Documents & Links for Anti GLRX2 pAb (ATL-HPA057224) | |
| Datasheet | Anti GLRX2 pAb (ATL-HPA057224) Datasheet (External Link) |
| Vendor Page | Anti GLRX2 pAb (ATL-HPA057224) |