Anti GLRX2 pAb (ATL-HPA023087)

Atlas Antibodies

Catalog No.:
ATL-HPA023087-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: glutaredoxin 2
Gene Name: GLRX2
Alternative Gene Name: bA101E13.1, GRX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018196: 93%, ENSRNOG00000003385: 91%
Entrez Gene ID: 51022
Uniprot ID: Q9NS18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL
Gene Sequence DMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL
Gene ID - Mouse ENSMUSG00000018196
Gene ID - Rat ENSRNOG00000003385
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLRX2 pAb (ATL-HPA023087)
Datasheet Anti GLRX2 pAb (ATL-HPA023087) Datasheet (External Link)
Vendor Page Anti GLRX2 pAb (ATL-HPA023087) at Atlas Antibodies

Documents & Links for Anti GLRX2 pAb (ATL-HPA023087)
Datasheet Anti GLRX2 pAb (ATL-HPA023087) Datasheet (External Link)
Vendor Page Anti GLRX2 pAb (ATL-HPA023087)