Anti GLRB pAb (ATL-HPA052363)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052363-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GLRB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028020: 97%, ENSRNOG00000010199: 97%
Entrez Gene ID: 2743
Uniprot ID: P48167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MLNNPKRVEAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAK |
Gene Sequence | MLNNPKRVEAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAK |
Gene ID - Mouse | ENSMUSG00000028020 |
Gene ID - Rat | ENSRNOG00000010199 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GLRB pAb (ATL-HPA052363) | |
Datasheet | Anti GLRB pAb (ATL-HPA052363) Datasheet (External Link) |
Vendor Page | Anti GLRB pAb (ATL-HPA052363) at Atlas Antibodies |
Documents & Links for Anti GLRB pAb (ATL-HPA052363) | |
Datasheet | Anti GLRB pAb (ATL-HPA052363) Datasheet (External Link) |
Vendor Page | Anti GLRB pAb (ATL-HPA052363) |