Anti GLRA4 pAb (ATL-HPA044759)

Atlas Antibodies

SKU:
ATL-HPA044759-25
  • Immunohistochemical staining of human prostate shows moderate membranous positivity in glandular cells and cytoplasmic positivity in smooth muscle cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: glycine receptor, alpha 4
Gene Name: GLRA4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018595: 90%, ENSRNOG00000002391: 81%
Entrez Gene ID: 441509
Uniprot ID: Q5JXX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRLRRRQRRQRLEEDIIQESRFYFRGYGLGHCLQARDGGPMEGSGIYSPQPPAPLLREGETTRKLYVD
Gene Sequence IRLRRRQRRQRLEEDIIQESRFYFRGYGLGHCLQARDGGPMEGSGIYSPQPPAPLLREGETTRKLYVD
Gene ID - Mouse ENSMUSG00000018595
Gene ID - Rat ENSRNOG00000002391
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLRA4 pAb (ATL-HPA044759)
Datasheet Anti GLRA4 pAb (ATL-HPA044759) Datasheet (External Link)
Vendor Page Anti GLRA4 pAb (ATL-HPA044759) at Atlas Antibodies

Documents & Links for Anti GLRA4 pAb (ATL-HPA044759)
Datasheet Anti GLRA4 pAb (ATL-HPA044759) Datasheet (External Link)
Vendor Page Anti GLRA4 pAb (ATL-HPA044759)