Anti GLP2R pAb (ATL-HPA049244)

Atlas Antibodies

Catalog No.:
ATL-HPA049244-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glucagon-like peptide 2 receptor
Gene Name: GLP2R
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049928: 59%, ENSRNOG00000003683: 67%
Entrez Gene ID: 9340
Uniprot ID: O95838
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPC
Gene Sequence LPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPC
Gene ID - Mouse ENSMUSG00000049928
Gene ID - Rat ENSRNOG00000003683
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLP2R pAb (ATL-HPA049244)
Datasheet Anti GLP2R pAb (ATL-HPA049244) Datasheet (External Link)
Vendor Page Anti GLP2R pAb (ATL-HPA049244) at Atlas Antibodies

Documents & Links for Anti GLP2R pAb (ATL-HPA049244)
Datasheet Anti GLP2R pAb (ATL-HPA049244) Datasheet (External Link)
Vendor Page Anti GLP2R pAb (ATL-HPA049244)