Anti GLOD4 pAb (ATL-HPA023246 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA023246-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glyoxalase domain containing 4
Gene Name: GLOD4
Alternative Gene Name: C17orf25, CGI-150, HC71
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017286: 93%, ENSRNOG00000007788: 87%
Entrez Gene ID: 51031
Uniprot ID: Q9HC38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen KSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMK
Gene Sequence KSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMK
Gene ID - Mouse ENSMUSG00000017286
Gene ID - Rat ENSRNOG00000007788
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLOD4 pAb (ATL-HPA023246 w/enhanced validation)
Datasheet Anti GLOD4 pAb (ATL-HPA023246 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLOD4 pAb (ATL-HPA023246 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GLOD4 pAb (ATL-HPA023246 w/enhanced validation)
Datasheet Anti GLOD4 pAb (ATL-HPA023246 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLOD4 pAb (ATL-HPA023246 w/enhanced validation)