Anti GLO1 pAb (ATL-HPA059791)

Atlas Antibodies

SKU:
ATL-HPA059791-100
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: glyoxalase I
Gene Name: GLO1
Alternative Gene Name: GLOD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024026: 87%, ENSRNOG00000000541: 90%
Entrez Gene ID: 2739
Uniprot ID: Q04760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDK
Gene Sequence MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDK
Gene ID - Mouse ENSMUSG00000024026
Gene ID - Rat ENSRNOG00000000541
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLO1 pAb (ATL-HPA059791)
Datasheet Anti GLO1 pAb (ATL-HPA059791) Datasheet (External Link)
Vendor Page Anti GLO1 pAb (ATL-HPA059791) at Atlas Antibodies

Documents & Links for Anti GLO1 pAb (ATL-HPA059791)
Datasheet Anti GLO1 pAb (ATL-HPA059791) Datasheet (External Link)
Vendor Page Anti GLO1 pAb (ATL-HPA059791)