Anti GLO1 pAb (ATL-HPA059791)
Atlas Antibodies
- SKU:
- ATL-HPA059791-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: GLO1
Alternative Gene Name: GLOD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024026: 87%, ENSRNOG00000000541: 90%
Entrez Gene ID: 2739
Uniprot ID: Q04760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDK |
Gene Sequence | MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDK |
Gene ID - Mouse | ENSMUSG00000024026 |
Gene ID - Rat | ENSRNOG00000000541 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GLO1 pAb (ATL-HPA059791) | |
Datasheet | Anti GLO1 pAb (ATL-HPA059791) Datasheet (External Link) |
Vendor Page | Anti GLO1 pAb (ATL-HPA059791) at Atlas Antibodies |
Documents & Links for Anti GLO1 pAb (ATL-HPA059791) | |
Datasheet | Anti GLO1 pAb (ATL-HPA059791) Datasheet (External Link) |
Vendor Page | Anti GLO1 pAb (ATL-HPA059791) |