Anti GLO1 pAb (ATL-HPA059791)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059791-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: GLO1
Alternative Gene Name: GLOD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024026: 87%, ENSRNOG00000000541: 90%
Entrez Gene ID: 2739
Uniprot ID: Q04760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDK |
| Gene Sequence | MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDK |
| Gene ID - Mouse | ENSMUSG00000024026 |
| Gene ID - Rat | ENSRNOG00000000541 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GLO1 pAb (ATL-HPA059791) | |
| Datasheet | Anti GLO1 pAb (ATL-HPA059791) Datasheet (External Link) |
| Vendor Page | Anti GLO1 pAb (ATL-HPA059791) at Atlas Antibodies |
| Documents & Links for Anti GLO1 pAb (ATL-HPA059791) | |
| Datasheet | Anti GLO1 pAb (ATL-HPA059791) Datasheet (External Link) |
| Vendor Page | Anti GLO1 pAb (ATL-HPA059791) |