Anti GLIS2 pAb (ATL-HPA062755)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062755-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GLIS2
Alternative Gene Name: NPHP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014303: 92%, ENSRNOG00000004766: 92%
Entrez Gene ID: 84662
Uniprot ID: Q9BZE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSS |
Gene Sequence | VEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSS |
Gene ID - Mouse | ENSMUSG00000014303 |
Gene ID - Rat | ENSRNOG00000004766 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GLIS2 pAb (ATL-HPA062755) | |
Datasheet | Anti GLIS2 pAb (ATL-HPA062755) Datasheet (External Link) |
Vendor Page | Anti GLIS2 pAb (ATL-HPA062755) at Atlas Antibodies |
Documents & Links for Anti GLIS2 pAb (ATL-HPA062755) | |
Datasheet | Anti GLIS2 pAb (ATL-HPA062755) Datasheet (External Link) |
Vendor Page | Anti GLIS2 pAb (ATL-HPA062755) |