Anti GLIS2 pAb (ATL-HPA062755)

Atlas Antibodies

Catalog No.:
ATL-HPA062755-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GLIS family zinc finger 2
Gene Name: GLIS2
Alternative Gene Name: NPHP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014303: 92%, ENSRNOG00000004766: 92%
Entrez Gene ID: 84662
Uniprot ID: Q9BZE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSS
Gene Sequence VEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSS
Gene ID - Mouse ENSMUSG00000014303
Gene ID - Rat ENSRNOG00000004766
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLIS2 pAb (ATL-HPA062755)
Datasheet Anti GLIS2 pAb (ATL-HPA062755) Datasheet (External Link)
Vendor Page Anti GLIS2 pAb (ATL-HPA062755) at Atlas Antibodies

Documents & Links for Anti GLIS2 pAb (ATL-HPA062755)
Datasheet Anti GLIS2 pAb (ATL-HPA062755) Datasheet (External Link)
Vendor Page Anti GLIS2 pAb (ATL-HPA062755)