Anti GLIPR1 pAb (ATL-HPA011014)

Atlas Antibodies

SKU:
ATL-HPA011014-25
  • Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GLI pathogenesis-related 1
Gene Name: GLIPR1
Alternative Gene Name: GliPR, RTVP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056888: 65%, ENSRNOG00000026644: 61%
Entrez Gene ID: 11010
Uniprot ID: P48060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDF
Gene Sequence NEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDF
Gene ID - Mouse ENSMUSG00000056888
Gene ID - Rat ENSRNOG00000026644
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLIPR1 pAb (ATL-HPA011014)
Datasheet Anti GLIPR1 pAb (ATL-HPA011014) Datasheet (External Link)
Vendor Page Anti GLIPR1 pAb (ATL-HPA011014) at Atlas Antibodies

Documents & Links for Anti GLIPR1 pAb (ATL-HPA011014)
Datasheet Anti GLIPR1 pAb (ATL-HPA011014) Datasheet (External Link)
Vendor Page Anti GLIPR1 pAb (ATL-HPA011014)