Anti GLI1 pAb (ATL-HPA068903)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068903-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GLI1
Alternative Gene Name: GLI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025407: 67%, ENSRNOG00000025120: 65%
Entrez Gene ID: 2735
Uniprot ID: P08151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PCLDFDSPTHSTGQLKAQLVCNYVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYP |
Gene Sequence | PCLDFDSPTHSTGQLKAQLVCNYVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYP |
Gene ID - Mouse | ENSMUSG00000025407 |
Gene ID - Rat | ENSRNOG00000025120 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GLI1 pAb (ATL-HPA068903) | |
Datasheet | Anti GLI1 pAb (ATL-HPA068903) Datasheet (External Link) |
Vendor Page | Anti GLI1 pAb (ATL-HPA068903) at Atlas Antibodies |
Documents & Links for Anti GLI1 pAb (ATL-HPA068903) | |
Datasheet | Anti GLI1 pAb (ATL-HPA068903) Datasheet (External Link) |
Vendor Page | Anti GLI1 pAb (ATL-HPA068903) |