Anti GLE1 pAb (ATL-HPA061560)

Atlas Antibodies

Catalog No.:
ATL-HPA061560-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GLE1 RNA export mediator
Gene Name: GLE1
Alternative Gene Name: GLE1L, hGLE1, LCCS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019715: 92%, ENSRNOG00000015237: 89%
Entrez Gene ID: 2733
Uniprot ID: Q53GS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NEDLQVKVQDITMQWYQQLQDASMQCVLTFEGLTNSKDSQAKKIKMDLQKAATIPVSQISTIAGSKLKEIFDKIHSLLSGKPVQ
Gene Sequence NEDLQVKVQDITMQWYQQLQDASMQCVLTFEGLTNSKDSQAKKIKMDLQKAATIPVSQISTIAGSKLKEIFDKIHSLLSGKPVQ
Gene ID - Mouse ENSMUSG00000019715
Gene ID - Rat ENSRNOG00000015237
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLE1 pAb (ATL-HPA061560)
Datasheet Anti GLE1 pAb (ATL-HPA061560) Datasheet (External Link)
Vendor Page Anti GLE1 pAb (ATL-HPA061560) at Atlas Antibodies

Documents & Links for Anti GLE1 pAb (ATL-HPA061560)
Datasheet Anti GLE1 pAb (ATL-HPA061560) Datasheet (External Link)
Vendor Page Anti GLE1 pAb (ATL-HPA061560)