Anti GLDN pAb (ATL-HPA059441)

Atlas Antibodies

Catalog No.:
ATL-HPA059441-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: gliomedin
Gene Name: GLDN
Alternative Gene Name: CLOM, COLM, colmedin, CRG-L2, UNC-112
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046167: 81%, ENSRNOG00000024082: 82%
Entrez Gene ID: 342035
Uniprot ID: Q6ZMI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASAPPQDPASSARNKRSHSGEPAPHIRAESHDMLMMMTYSMVPIRVMVDLCNSTKGICLTGP
Gene Sequence ASAPPQDPASSARNKRSHSGEPAPHIRAESHDMLMMMTYSMVPIRVMVDLCNSTKGICLTGP
Gene ID - Mouse ENSMUSG00000046167
Gene ID - Rat ENSRNOG00000024082
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLDN pAb (ATL-HPA059441)
Datasheet Anti GLDN pAb (ATL-HPA059441) Datasheet (External Link)
Vendor Page Anti GLDN pAb (ATL-HPA059441) at Atlas Antibodies

Documents & Links for Anti GLDN pAb (ATL-HPA059441)
Datasheet Anti GLDN pAb (ATL-HPA059441) Datasheet (External Link)
Vendor Page Anti GLDN pAb (ATL-HPA059441)