Anti GLDC pAb (ATL-HPA052887 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052887-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GLDC
Alternative Gene Name: GCSP, NKH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024827: 91%, ENSRNOG00000011599: 92%
Entrez Gene ID: 2731
Uniprot ID: P23378
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENL |
| Gene Sequence | SCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENL |
| Gene ID - Mouse | ENSMUSG00000024827 |
| Gene ID - Rat | ENSRNOG00000011599 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GLDC pAb (ATL-HPA052887 w/enhanced validation) | |
| Datasheet | Anti GLDC pAb (ATL-HPA052887 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GLDC pAb (ATL-HPA052887 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GLDC pAb (ATL-HPA052887 w/enhanced validation) | |
| Datasheet | Anti GLDC pAb (ATL-HPA052887 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GLDC pAb (ATL-HPA052887 w/enhanced validation) |