Anti GLDC pAb (ATL-HPA002318 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA002318-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glycine dehydrogenase (decarboxylating)
Gene Name: GLDC
Alternative Gene Name: GCSP, NKH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024827: 96%, ENSRNOG00000011599: 96%
Entrez Gene ID: 2731
Uniprot ID: P23378
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPENK
Gene Sequence ILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPENK
Gene ID - Mouse ENSMUSG00000024827
Gene ID - Rat ENSRNOG00000011599
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLDC pAb (ATL-HPA002318 w/enhanced validation)
Datasheet Anti GLDC pAb (ATL-HPA002318 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLDC pAb (ATL-HPA002318 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GLDC pAb (ATL-HPA002318 w/enhanced validation)
Datasheet Anti GLDC pAb (ATL-HPA002318 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLDC pAb (ATL-HPA002318 w/enhanced validation)
Citations for Anti GLDC pAb (ATL-HPA002318 w/enhanced validation) – 6 Found
Kottakis, Filippos; Nicolay, Brandon N; Roumane, Ahlima; Karnik, Rahul; Gu, Hongcang; Nagle, Julia M; Boukhali, Myriam; Hayward, Michele C; Li, Yvonne Y; Chen, Ting; Liesa, Marc; Hammerman, Peter S; Wong, Kwok Kin; Hayes, D Neil; Shirihai, Orian S; Dyson, Nicholas J; Haas, Wilhelm; Meissner, Alexander; Bardeesy, Nabeel. LKB1 loss links serine metabolism to DNA methylation and tumorigenesis. Nature. 2016;539(7629):390-395.  PubMed
Jäger, Katharina; Larribère, Lionel; Wu, Huizi; Weiss, Christel; Gebhardt, Christoffer; Utikal, Jochen. Expression of Neural Crest Markers GLDC and ERRFI1 is Correlated with Melanoma Prognosis. Cancers. 2019;11(1)  PubMed
Tiwari, Vivek; Daoud, Elena V; Hatanpaa, Kimmo J; Gao, Ang; Zhang, Song; An, Zhongxu; Ganji, Sandeep K; Raisanen, Jack M; Lewis, Cheryl M; Askari, Pegah; Baxter, Jeannie; Levy, Michael; Dimitrov, Ivan; Thomas, Binu P; Pinho, Marco C; Madden, Christopher J; Pan, Edward; Patel, Toral R; DeBerardinis, Ralph J; Sherry, A Dean; Mickey, Bruce E; Malloy, Craig R; Maher, Elizabeth A; Choi, Changho. Glycine by MR spectroscopy is an imaging biomarker of glioma aggressiveness. Neuro-Oncology. 2020;22(7):1018-1029.  PubMed
Jog, Ruta; Chen, Guohua; Wang, Jian; Leff, Todd. Hormonal regulation of glycine decarboxylase and its relationship to oxidative stress. Physiological Reports. 2021;9(15):e14991.  PubMed
Kim, Dohoon; Fiske, Brian P; Birsoy, Kivanc; Freinkman, Elizaveta; Kami, Kenjiro; Possemato, Richard L; Chudnovsky, Yakov; Pacold, Michael E; Chen, Walter W; Cantor, Jason R; Shelton, Laura M; Gui, Dan Y; Kwon, Manjae; Ramkissoon, Shakti H; Ligon, Keith L; Kang, Seong Woo; Snuderl, Matija; Vander Heiden, Matthew G; Sabatini, David M. SHMT2 drives glioma cell survival in ischaemia but imposes a dependence on glycine clearance. Nature. 2015;520(7547):363-7.  PubMed
Santos, Chloe; Pai, Yun Jin; Mahmood, M Raasib; Leung, Kit-Yi; Savery, Dawn; Waddington, Simon N; Copp, Andrew J; Greene, Nicholas DE. Impaired folate 1-carbon metabolism causes formate-preventable hydrocephalus in glycine decarboxylase-deficient mice. The Journal Of Clinical Investigation. 2020;130(3):1446-1452.  PubMed