Anti GLCE pAb (ATL-HPA040481)

Atlas Antibodies

SKU:
ATL-HPA040481-25
  • Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glucuronic acid epimerase
Gene Name: GLCE
Alternative Gene Name: HSEPI, KIAA0836
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032252: 93%, ENSRNOG00000025372: 92%
Entrez Gene ID: 26035
Uniprot ID: O94923
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYDR
Gene Sequence SDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYDR
Gene ID - Mouse ENSMUSG00000032252
Gene ID - Rat ENSRNOG00000025372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GLCE pAb (ATL-HPA040481)
Datasheet Anti GLCE pAb (ATL-HPA040481) Datasheet (External Link)
Vendor Page Anti GLCE pAb (ATL-HPA040481) at Atlas Antibodies

Documents & Links for Anti GLCE pAb (ATL-HPA040481)
Datasheet Anti GLCE pAb (ATL-HPA040481) Datasheet (External Link)
Vendor Page Anti GLCE pAb (ATL-HPA040481)