Anti GLB1L2 pAb (ATL-HPA059955)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059955-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GLB1L2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036395: 79%, ENSRNOG00000007561: 77%
Entrez Gene ID: 89944
Uniprot ID: Q8IW92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DNKDGLSKGIVQGVLATINLQSTHELQLLTTFLFNVQGTQPKMVMEYWTGWFDSWGGPHNILDSSEVLKTVSAIVDAGSSINLY |
| Gene Sequence | DNKDGLSKGIVQGVLATINLQSTHELQLLTTFLFNVQGTQPKMVMEYWTGWFDSWGGPHNILDSSEVLKTVSAIVDAGSSINLY |
| Gene ID - Mouse | ENSMUSG00000036395 |
| Gene ID - Rat | ENSRNOG00000007561 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GLB1L2 pAb (ATL-HPA059955) | |
| Datasheet | Anti GLB1L2 pAb (ATL-HPA059955) Datasheet (External Link) |
| Vendor Page | Anti GLB1L2 pAb (ATL-HPA059955) at Atlas Antibodies |
| Documents & Links for Anti GLB1L2 pAb (ATL-HPA059955) | |
| Datasheet | Anti GLB1L2 pAb (ATL-HPA059955) Datasheet (External Link) |
| Vendor Page | Anti GLB1L2 pAb (ATL-HPA059955) |