Anti GLB1L2 pAb (ATL-HPA054808)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054808-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GLB1L2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036395: 74%, ENSRNOG00000007561: 80%
Entrez Gene ID: 89944
Uniprot ID: Q8IW92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RGRVNYGENIDDQRKGLIGNLYLNDSPLKNFRIYSLDMKKSFFQRFGLDKWSSL |
Gene Sequence | RGRVNYGENIDDQRKGLIGNLYLNDSPLKNFRIYSLDMKKSFFQRFGLDKWSSL |
Gene ID - Mouse | ENSMUSG00000036395 |
Gene ID - Rat | ENSRNOG00000007561 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GLB1L2 pAb (ATL-HPA054808) | |
Datasheet | Anti GLB1L2 pAb (ATL-HPA054808) Datasheet (External Link) |
Vendor Page | Anti GLB1L2 pAb (ATL-HPA054808) at Atlas Antibodies |
Documents & Links for Anti GLB1L2 pAb (ATL-HPA054808) | |
Datasheet | Anti GLB1L2 pAb (ATL-HPA054808) Datasheet (External Link) |
Vendor Page | Anti GLB1L2 pAb (ATL-HPA054808) |