Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA043058-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: galactosidase, beta 1-like
Gene Name: GLB1L
Alternative Gene Name: MGC10771
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026200: 70%, ENSRNOG00000019243: 67%
Entrez Gene ID: 79411
Uniprot ID: Q6UWU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GRYWTKQGPQQTLYVPRFLLFPRGALNKITLLELEDVPLQPQVQFLDKPILNSTSTLHRTHINSLSADTLSASEPMELSGH
Gene Sequence GRYWTKQGPQQTLYVPRFLLFPRGALNKITLLELEDVPLQPQVQFLDKPILNSTSTLHRTHINSLSADTLSASEPMELSGH
Gene ID - Mouse ENSMUSG00000026200
Gene ID - Rat ENSRNOG00000019243
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation)
Datasheet Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation)
Datasheet Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation)