Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA043058-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GLB1L
Alternative Gene Name: MGC10771
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026200: 70%, ENSRNOG00000019243: 67%
Entrez Gene ID: 79411
Uniprot ID: Q6UWU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GRYWTKQGPQQTLYVPRFLLFPRGALNKITLLELEDVPLQPQVQFLDKPILNSTSTLHRTHINSLSADTLSASEPMELSGH |
Gene Sequence | GRYWTKQGPQQTLYVPRFLLFPRGALNKITLLELEDVPLQPQVQFLDKPILNSTSTLHRTHINSLSADTLSASEPMELSGH |
Gene ID - Mouse | ENSMUSG00000026200 |
Gene ID - Rat | ENSRNOG00000019243 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation) | |
Datasheet | Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation) | |
Datasheet | Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GLB1L pAb (ATL-HPA043058 w/enhanced validation) |