Anti GLB1 pAb (ATL-HPA069503 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA069503-25

• 

Protein Description: galactosidase, beta 1
Gene Name: GLB1
Alternative Gene Name: EBP, ELNR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045594: 47%, ENSRNOG00000010196: 46%
Entrez Gene ID: 2720
Uniprot ID: P16278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV
• Gene Sequence: GRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV
• Gene ID - Mouse: ENSMUSG00000045594
• Gene ID - Rat: ENSRNOG00000010196
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.