Anti GLB1 pAb (ATL-HPA040610)

Atlas Antibodies

Catalog No.:
ATL-HPA040610-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: galactosidase, beta 1
Gene Name: GLB1
Alternative Gene Name: EBP, ELNR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045594: 47%, ENSRNOG00000010196: 46%
Entrez Gene ID: 2720
Uniprot ID: P16278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV
Gene Sequence GRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV
Gene ID - Mouse ENSMUSG00000045594
Gene ID - Rat ENSRNOG00000010196
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GLB1 pAb (ATL-HPA040610)
Datasheet Anti GLB1 pAb (ATL-HPA040610) Datasheet (External Link)
Vendor Page Anti GLB1 pAb (ATL-HPA040610) at Atlas Antibodies

Documents & Links for Anti GLB1 pAb (ATL-HPA040610)
Datasheet Anti GLB1 pAb (ATL-HPA040610) Datasheet (External Link)
Vendor Page Anti GLB1 pAb (ATL-HPA040610)