Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA066173-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: G kinase anchoring protein 1
Gene Name: GKAP1
Alternative Gene Name: FKSG21, GKAP42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021552: 78%, ENSRNOG00000019272: 84%
Entrez Gene ID: 80318
Uniprot ID: Q5VSY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLEYEEHKKEYEDAENTSTQSKVMNK
Gene Sequence QKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLEYEEHKKEYEDAENTSTQSKVMNK
Gene ID - Mouse ENSMUSG00000021552
Gene ID - Rat ENSRNOG00000019272
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation)
Datasheet Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation)
Datasheet Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation)