Anti GKAP1 pAb (ATL-HPA066173 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA066173-25

• 
• 

Protein Description: G kinase anchoring protein 1
Gene Name: GKAP1
Alternative Gene Name: FKSG21, GKAP42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021552: 78%, ENSRNOG00000019272: 84%
Entrez Gene ID: 80318
Uniprot ID: Q5VSY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLEYEEHKKEYEDAENTSTQSKVMNK
• Gene Sequence: QKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLEYEEHKKEYEDAENTSTQSKVMNK
• Gene ID - Mouse: ENSMUSG00000021552
• Gene ID - Rat: ENSRNOG00000019272
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.