Anti GK pAb (ATL-HPA060687)

Atlas Antibodies

Catalog No.:
ATL-HPA060687-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glycerol kinase
Gene Name: GK
Alternative Gene Name: GK1, GKD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025059: 96%, ENSRNOG00000034116: 96%
Entrez Gene ID: 2710
Uniprot ID: P32189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IERLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPL
Gene Sequence IERLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPL
Gene ID - Mouse ENSMUSG00000025059
Gene ID - Rat ENSRNOG00000034116
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GK pAb (ATL-HPA060687)
Datasheet Anti GK pAb (ATL-HPA060687) Datasheet (External Link)
Vendor Page Anti GK pAb (ATL-HPA060687) at Atlas Antibodies

Documents & Links for Anti GK pAb (ATL-HPA060687)
Datasheet Anti GK pAb (ATL-HPA060687) Datasheet (External Link)
Vendor Page Anti GK pAb (ATL-HPA060687)