Anti GJB7 pAb (ATL-HPA014392)

Atlas Antibodies

Catalog No.: ATL-HPA014392-25

Protein Description: gap junction protein beta 7
Gene Name: GJB7
Alternative Gene Name: bA136M9.1, CX25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048582: 68%, ENSRNOG00000008847: 68%
Entrez Gene ID: 375519
Uniprot ID: Q6PEY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFI
• Gene Sequence: YKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFI
• Gene ID - Mouse: ENSMUSG00000048582
• Gene ID - Rat: ENSRNOG00000008847
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.