Anti GJB7 pAb (ATL-HPA014392)

Atlas Antibodies

Catalog No.:
ATL-HPA014392-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: gap junction protein beta 7
Gene Name: GJB7
Alternative Gene Name: bA136M9.1, CX25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048582: 68%, ENSRNOG00000008847: 68%
Entrez Gene ID: 375519
Uniprot ID: Q6PEY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFI
Gene Sequence YKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFI
Gene ID - Mouse ENSMUSG00000048582
Gene ID - Rat ENSRNOG00000008847
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GJB7 pAb (ATL-HPA014392)
Datasheet Anti GJB7 pAb (ATL-HPA014392) Datasheet (External Link)
Vendor Page Anti GJB7 pAb (ATL-HPA014392) at Atlas Antibodies

Documents & Links for Anti GJB7 pAb (ATL-HPA014392)
Datasheet Anti GJB7 pAb (ATL-HPA014392) Datasheet (External Link)
Vendor Page Anti GJB7 pAb (ATL-HPA014392)