Anti GJB5 pAb (ATL-HPA038146 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA038146-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: gap junction protein, beta 5, 31.1kDa
Gene Name: GJB5
Alternative Gene Name: CX31.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042357: 57%, ENSRNOG00000059897: 57%
Entrez Gene ID: 2709
Uniprot ID: O95377
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLLPDRPRDHVKK
Gene Sequence KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLLPDRPRDHVKK
Gene ID - Mouse ENSMUSG00000042357
Gene ID - Rat ENSRNOG00000059897
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GJB5 pAb (ATL-HPA038146 w/enhanced validation)
Datasheet Anti GJB5 pAb (ATL-HPA038146 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GJB5 pAb (ATL-HPA038146 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GJB5 pAb (ATL-HPA038146 w/enhanced validation)
Datasheet Anti GJB5 pAb (ATL-HPA038146 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GJB5 pAb (ATL-HPA038146 w/enhanced validation)