Anti GJB5 pAb (ATL-HPA038146 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038146-25

• 
• 

Protein Description: gap junction protein, beta 5, 31.1kDa
Gene Name: GJB5
Alternative Gene Name: CX31.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042357: 57%, ENSRNOG00000059897: 57%
Entrez Gene ID: 2709
Uniprot ID: O95377
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLLPDRPRDHVKK
• Gene Sequence: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLLPDRPRDHVKK
• Gene ID - Mouse: ENSMUSG00000042357
• Gene ID - Rat: ENSRNOG00000059897
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.