Anti GJA8 pAb (ATL-HPA062940 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA062940-25

• 

Protein Description: gap junction protein alpha 8
Gene Name: GJA8
Alternative Gene Name: CAE, CAE1, CX50, CZP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049908: 71%, ENSRNOG00000046703: 71%
Entrez Gene ID: 2703
Uniprot ID: P48165
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHYVRMEEKRKSREAEELGQQAGTNGGPDQGSVKKSSGSKGTKKFRLEGTLL
• Gene Sequence: VHYVRMEEKRKSREAEELGQQAGTNGGPDQGSVKKSSGSKGTKKFRLEGTLL
• Gene ID - Mouse: ENSMUSG00000049908
• Gene ID - Rat: ENSRNOG00000046703
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.