Anti GJA1 pAb (ATL-HPA047551)

Atlas Antibodies

SKU:
ATL-HPA047551-25
  • Immunofluorescent staining of human cell line AF22 shows localization to cell junctions & vesicles.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: gap junction protein alpha 1
Gene Name: GJA1
Alternative Gene Name: CX43, GJAL, ODD, ODDD, ODOD, SDTY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050953: 92%, ENSRNOG00000000805: 92%
Entrez Gene ID: 2697
Uniprot ID: P17302
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQAS
Gene Sequence GKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQAS
Gene ID - Mouse ENSMUSG00000050953
Gene ID - Rat ENSRNOG00000000805
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GJA1 pAb (ATL-HPA047551)
Datasheet Anti GJA1 pAb (ATL-HPA047551) Datasheet (External Link)
Vendor Page Anti GJA1 pAb (ATL-HPA047551) at Atlas Antibodies

Documents & Links for Anti GJA1 pAb (ATL-HPA047551)
Datasheet Anti GJA1 pAb (ATL-HPA047551) Datasheet (External Link)
Vendor Page Anti GJA1 pAb (ATL-HPA047551)