Anti GIPC2 pAb (ATL-HPA062684)

Atlas Antibodies

Catalog No.:
ATL-HPA062684-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: GIPC PDZ domain containing family, member 2
Gene Name: GIPC2
Alternative Gene Name: FLJ20075, SEMCAP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039131: 82%, ENSRNOG00000042152: 82%
Entrez Gene ID: 54810
Uniprot ID: Q8TF65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SATGRVEGFSSIQELYAQIAGAFEISPSEILYCTLNTPKIDMER
Gene Sequence SATGRVEGFSSIQELYAQIAGAFEISPSEILYCTLNTPKIDMER
Gene ID - Mouse ENSMUSG00000039131
Gene ID - Rat ENSRNOG00000042152
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GIPC2 pAb (ATL-HPA062684)
Datasheet Anti GIPC2 pAb (ATL-HPA062684) Datasheet (External Link)
Vendor Page Anti GIPC2 pAb (ATL-HPA062684) at Atlas Antibodies

Documents & Links for Anti GIPC2 pAb (ATL-HPA062684)
Datasheet Anti GIPC2 pAb (ATL-HPA062684) Datasheet (External Link)
Vendor Page Anti GIPC2 pAb (ATL-HPA062684)