Anti GIPC2 pAb (ATL-HPA062684)

Atlas Antibodies

Catalog No.: ATL-HPA062684-25

Protein Description: GIPC PDZ domain containing family, member 2
Gene Name: GIPC2
Alternative Gene Name: FLJ20075, SEMCAP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039131: 82%, ENSRNOG00000042152: 82%
Entrez Gene ID: 54810
Uniprot ID: Q8TF65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SATGRVEGFSSIQELYAQIAGAFEISPSEILYCTLNTPKIDMER
• Gene Sequence: SATGRVEGFSSIQELYAQIAGAFEISPSEILYCTLNTPKIDMER
• Gene ID - Mouse: ENSMUSG00000039131
• Gene ID - Rat: ENSRNOG00000042152
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.