Anti GIP pAb (ATL-HPA064596 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA064596-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: gastric inhibitory polypeptide
Gene Name: GIP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014351: 67%, ENSRNOG00000006306: 68%
Entrez Gene ID: 2695
Uniprot ID: P09681
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DWKHNITQREARALELAGQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLC
Gene Sequence DWKHNITQREARALELAGQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLC
Gene ID - Mouse ENSMUSG00000014351
Gene ID - Rat ENSRNOG00000006306
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GIP pAb (ATL-HPA064596 w/enhanced validation)
Datasheet Anti GIP pAb (ATL-HPA064596 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GIP pAb (ATL-HPA064596 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GIP pAb (ATL-HPA064596 w/enhanced validation)
Datasheet Anti GIP pAb (ATL-HPA064596 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GIP pAb (ATL-HPA064596 w/enhanced validation)