Anti GINS1 pAb (ATL-HPA051185)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051185-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GINS1
Alternative Gene Name: KIAA0186, PSF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027454: 94%, ENSRNOG00000008091: 94%
Entrez Gene ID: 9837
Uniprot ID: Q14691
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEH |
Gene Sequence | HMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEH |
Gene ID - Mouse | ENSMUSG00000027454 |
Gene ID - Rat | ENSRNOG00000008091 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GINS1 pAb (ATL-HPA051185) | |
Datasheet | Anti GINS1 pAb (ATL-HPA051185) Datasheet (External Link) |
Vendor Page | Anti GINS1 pAb (ATL-HPA051185) at Atlas Antibodies |
Documents & Links for Anti GINS1 pAb (ATL-HPA051185) | |
Datasheet | Anti GINS1 pAb (ATL-HPA051185) Datasheet (External Link) |
Vendor Page | Anti GINS1 pAb (ATL-HPA051185) |