Anti GIMAP8 pAb (ATL-HPA014474 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA014474-25
  • Immunohistochemical staining of human lymph node shows cytoplasmic positivity in germinal center cells and non-germinal center cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GIMAP8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406278).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: GTPase, IMAP family member 8
Gene Name: GIMAP8
Alternative Gene Name: DKFZp667I133, hIAN6, IAN9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064262: 54%, ENSRNOG00000020169: 56%
Entrez Gene ID: 155038
Uniprot ID: Q8ND71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDISSLKNIDSEVRKHICTGPHAFLLVTPLGFYTKNDEAVLSTIQNNFGEKFFEYMIILLTRKEDLGDQDLDTFLRNSNKALYGLIQKCKNRYSAFNYRATGEEEQRQADELLEKIESMVHQNGNK
Gene Sequence PDISSLKNIDSEVRKHICTGPHAFLLVTPLGFYTKNDEAVLSTIQNNFGEKFFEYMIILLTRKEDLGDQDLDTFLRNSNKALYGLIQKCKNRYSAFNYRATGEEEQRQADELLEKIESMVHQNGNK
Gene ID - Mouse ENSMUSG00000064262
Gene ID - Rat ENSRNOG00000020169
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GIMAP8 pAb (ATL-HPA014474 w/enhanced validation)
Datasheet Anti GIMAP8 pAb (ATL-HPA014474 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GIMAP8 pAb (ATL-HPA014474 w/enhanced validation)