Anti GIMAP8 pAb (ATL-HPA014474 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014474-25

Protein Description: GTPase, IMAP family member 8
Gene Name: GIMAP8
Alternative Gene Name: DKFZp667I133, hIAN6, IAN9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064262: 54%, ENSRNOG00000020169: 56%
Entrez Gene ID: 155038
Uniprot ID: Q8ND71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDISSLKNIDSEVRKHICTGPHAFLLVTPLGFYTKNDEAVLSTIQNNFGEKFFEYMIILLTRKEDLGDQDLDTFLRNSNKALYGLIQKCKNRYSAFNYRATGEEEQRQADELLEKIESMVHQNGNK
• Gene Sequence: PDISSLKNIDSEVRKHICTGPHAFLLVTPLGFYTKNDEAVLSTIQNNFGEKFFEYMIILLTRKEDLGDQDLDTFLRNSNKALYGLIQKCKNRYSAFNYRATGEEEQRQADELLEKIESMVHQNGNK
• Gene ID - Mouse: ENSMUSG00000064262
• Gene ID - Rat: ENSRNOG00000020169
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.