Anti GIMAP7 pAb (ATL-HPA020268 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA020268-25

• 
• 

Protein Description: GTPase, IMAP family member 7
Gene Name: GIMAP7
Alternative Gene Name: IAN7, MGC27027
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043931: 58%, ENSRNOG00000038740: 50%
Entrez Gene ID: 168537
Uniprot ID: Q8NHV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEV
• Gene Sequence: FHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEV
• Gene ID - Mouse: ENSMUSG00000043931
• Gene ID - Rat: ENSRNOG00000038740
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GIMAP7 pAb (ATL-HPA020268 w/enhanced validation) – 2 Found

Meng, Zibo; Ren, Dianyun; Zhang, Kun; Zhao, Jingyuan; Jin, Xin; Wu, Heshui. Using ESTIMATE algorithm to establish an 8-mRNA signature prognosis prediction system and identify immunocyte infiltration-related genes in Pancreatic adenocarcinoma. Aging. 2020;12(6):5048-5070. 

Yao, Yikun; Du Jiang, Ping; Chao, Brittany N; Cagdas, Deniz; Kubo, Satoshi; Balasubramaniyam, Arasu; Zhang, Yu; Shadur, Bella; NaserEddin, Adeeb; Folio, Les R; Schwarz, Benjamin; Bohrnsen, Eric; Zheng, Lixin; Lynberg, Matthew; Gottlieb, Simone; Leney-Greene, Michael A; Park, Ann Y; Tezcan, Ilhan; Akdogan, Ali; Gocmen, Rahsan; Onder, Sevgen; Rosenberg, Avi; Soilleux, Elizabeth J; Johnson, Errin; Jackson, Peter K; Demeter, Janos; Chauvin, Samuel D; Paul, Florian; Selbach, Matthias; Bulut, Haydar; Clatworthy, Menna R; Tuong, Zewen K; Zhang, Hanlin; Stewart, Benjamin J; Bosio, Catharine M; Stepensky, Polina; Clare, Simon; Ganesan, Sundar; Pascall, John C; Daumke, Oliver; Butcher, Geoffrey W; McMichael, Andrew J; Simon, Anna Katharina; Lenardo, Michael J. GIMAP6 regulates autophagy, immune competence, and inflammation in mice and humans. The Journal Of Experimental Medicine. 2022;219(6)