Anti GIMAP7 pAb (ATL-HPA020268 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020268-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GIMAP7
Alternative Gene Name: IAN7, MGC27027
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043931: 58%, ENSRNOG00000038740: 50%
Entrez Gene ID: 168537
Uniprot ID: Q8NHV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEV |
| Gene Sequence | FHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEV |
| Gene ID - Mouse | ENSMUSG00000043931 |
| Gene ID - Rat | ENSRNOG00000038740 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GIMAP7 pAb (ATL-HPA020268 w/enhanced validation) | |
| Datasheet | Anti GIMAP7 pAb (ATL-HPA020268 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GIMAP7 pAb (ATL-HPA020268 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GIMAP7 pAb (ATL-HPA020268 w/enhanced validation) | |
| Datasheet | Anti GIMAP7 pAb (ATL-HPA020268 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GIMAP7 pAb (ATL-HPA020268 w/enhanced validation) |
| Citations for Anti GIMAP7 pAb (ATL-HPA020268 w/enhanced validation) – 2 Found |
| Meng, Zibo; Ren, Dianyun; Zhang, Kun; Zhao, Jingyuan; Jin, Xin; Wu, Heshui. Using ESTIMATE algorithm to establish an 8-mRNA signature prognosis prediction system and identify immunocyte infiltration-related genes in Pancreatic adenocarcinoma. Aging. 2020;12(6):5048-5070. PubMed |
| Yao, Yikun; Du Jiang, Ping; Chao, Brittany N; Cagdas, Deniz; Kubo, Satoshi; Balasubramaniyam, Arasu; Zhang, Yu; Shadur, Bella; NaserEddin, Adeeb; Folio, Les R; Schwarz, Benjamin; Bohrnsen, Eric; Zheng, Lixin; Lynberg, Matthew; Gottlieb, Simone; Leney-Greene, Michael A; Park, Ann Y; Tezcan, Ilhan; Akdogan, Ali; Gocmen, Rahsan; Onder, Sevgen; Rosenberg, Avi; Soilleux, Elizabeth J; Johnson, Errin; Jackson, Peter K; Demeter, Janos; Chauvin, Samuel D; Paul, Florian; Selbach, Matthias; Bulut, Haydar; Clatworthy, Menna R; Tuong, Zewen K; Zhang, Hanlin; Stewart, Benjamin J; Bosio, Catharine M; Stepensky, Polina; Clare, Simon; Ganesan, Sundar; Pascall, John C; Daumke, Oliver; Butcher, Geoffrey W; McMichael, Andrew J; Simon, Anna Katharina; Lenardo, Michael J. GIMAP6 regulates autophagy, immune competence, and inflammation in mice and humans. The Journal Of Experimental Medicine. 2022;219(6) PubMed |