Anti GIMAP7 pAb (ATL-HPA020266 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA020266-25

• 
• 
• 

Protein Description: GTPase, IMAP family member 7
Gene Name: GIMAP7
Alternative Gene Name: IAN7, MGC27027
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043931: 77%, ENSRNOG00000038740: 80%
Entrez Gene ID: 168537
Uniprot ID: Q8NHV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDT
• Gene Sequence: MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDT
• Gene ID - Mouse: ENSMUSG00000043931
• Gene ID - Rat: ENSRNOG00000038740
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.