Anti GIMAP4 pAb (ATL-HPA019137 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA019137-25

• 
• 

Protein Description: GTPase, IMAP family member 4
Gene Name: GIMAP4
Alternative Gene Name: FLJ11110, HIMAP4, IAN1, IMAP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054435: 63%, ENSRNOG00000008369: 61%
Entrez Gene ID: 55303
Uniprot ID: Q9NUV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAAQYGSMSFNPSTPGASYGPGRQEPRNSQLRIVLVGKTGAGKSATGNSILGRKVFHSGTAAKSITKKCEKRSSSWKETELVVVDTPG
• Gene Sequence: MAAQYGSMSFNPSTPGASYGPGRQEPRNSQLRIVLVGKTGAGKSATGNSILGRKVFHSGTAAKSITKKCEKRSSSWKETELVVVDTPG
• Gene ID - Mouse: ENSMUSG00000054435
• Gene ID - Rat: ENSRNOG00000008369
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GIMAP4 pAb (ATL-HPA019137 w/enhanced validation) – 1 Found

Yao, Yikun; Du Jiang, Ping; Chao, Brittany N; Cagdas, Deniz; Kubo, Satoshi; Balasubramaniyam, Arasu; Zhang, Yu; Shadur, Bella; NaserEddin, Adeeb; Folio, Les R; Schwarz, Benjamin; Bohrnsen, Eric; Zheng, Lixin; Lynberg, Matthew; Gottlieb, Simone; Leney-Greene, Michael A; Park, Ann Y; Tezcan, Ilhan; Akdogan, Ali; Gocmen, Rahsan; Onder, Sevgen; Rosenberg, Avi; Soilleux, Elizabeth J; Johnson, Errin; Jackson, Peter K; Demeter, Janos; Chauvin, Samuel D; Paul, Florian; Selbach, Matthias; Bulut, Haydar; Clatworthy, Menna R; Tuong, Zewen K; Zhang, Hanlin; Stewart, Benjamin J; Bosio, Catharine M; Stepensky, Polina; Clare, Simon; Ganesan, Sundar; Pascall, John C; Daumke, Oliver; Butcher, Geoffrey W; McMichael, Andrew J; Simon, Anna Katharina; Lenardo, Michael J. GIMAP6 regulates autophagy, immune competence, and inflammation in mice and humans. The Journal Of Experimental Medicine. 2022;219(6)