Anti GIMAP4 pAb (ATL-HPA019135 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA019135-25

• 
• 

Protein Description: GTPase, IMAP family member 4
Gene Name: GIMAP4
Alternative Gene Name: FLJ11110, HIMAP4, IAN1, IMAP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054435: 55%, ENSRNOG00000008369: 55%
Entrez Gene ID: 55303
Uniprot ID: Q9NUV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNRMYQRAEEEIQKQTQAMQELHRVELE
• Gene Sequence: EDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNRMYQRAEEEIQKQTQAMQELHRVELE
• Gene ID - Mouse: ENSMUSG00000054435
• Gene ID - Rat: ENSRNOG00000008369
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.