Anti GIMAP4 pAb (ATL-HPA019135 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019135-25
  • Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-GIMAP4 antibody. Corresponding GIMAP4 RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GIMAP4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413123).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: GTPase, IMAP family member 4
Gene Name: GIMAP4
Alternative Gene Name: FLJ11110, HIMAP4, IAN1, IMAP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054435: 55%, ENSRNOG00000008369: 55%
Entrez Gene ID: 55303
Uniprot ID: Q9NUV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNRMYQRAEEEIQKQTQAMQELHRVELE
Gene Sequence EDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNRMYQRAEEEIQKQTQAMQELHRVELE
Gene ID - Mouse ENSMUSG00000054435
Gene ID - Rat ENSRNOG00000008369
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GIMAP4 pAb (ATL-HPA019135 w/enhanced validation)
Datasheet Anti GIMAP4 pAb (ATL-HPA019135 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GIMAP4 pAb (ATL-HPA019135 w/enhanced validation)