Anti GIMAP2 pAb (ATL-HPA013589 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA013589-100

• 
• 

Protein Description: GTPase, IMAP family member 2
Gene Name: GIMAP2
Alternative Gene Name: DKFZp586D0824, HIMAP2, IAN12, IMAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090019: 29%, ENSRNOG00000008416: 33%
Entrez Gene ID: 26157
Uniprot ID: Q9UG22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTA
• Gene Sequence: ACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTA
• Gene ID - Mouse: ENSMUSG00000090019
• Gene ID - Rat: ENSRNOG00000008416
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GIMAP2 pAb (ATL-HPA013589 w/enhanced validation) – 1 Found

Komatsu, Mari; Saito, Kengo; Miyamoto, Isao; Koike, Kazuyuki; Iyoda, Manabu; Nakashima, Dai; Kasamatsu, Atsushi; Shiiba, Masashi; Tanzawa, Hideki; Uzawa, Katsuhiro. Aberrant GIMAP2 expression affects oral squamous cell carcinoma progression by promoting cell cycle and inhibiting apoptosis. Oncology Letters. 2022;23(2):49.