Anti GIMAP2 pAb (ATL-HPA013589 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA013589-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: GIMAP2
Alternative Gene Name: DKFZp586D0824, HIMAP2, IAN12, IMAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090019: 29%, ENSRNOG00000008416: 33%
Entrez Gene ID: 26157
Uniprot ID: Q9UG22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTA |
| Gene Sequence | ACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTA |
| Gene ID - Mouse | ENSMUSG00000090019 |
| Gene ID - Rat | ENSRNOG00000008416 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GIMAP2 pAb (ATL-HPA013589 w/enhanced validation) | |
| Datasheet | Anti GIMAP2 pAb (ATL-HPA013589 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GIMAP2 pAb (ATL-HPA013589 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GIMAP2 pAb (ATL-HPA013589 w/enhanced validation) | |
| Datasheet | Anti GIMAP2 pAb (ATL-HPA013589 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GIMAP2 pAb (ATL-HPA013589 w/enhanced validation) |
| Citations for Anti GIMAP2 pAb (ATL-HPA013589 w/enhanced validation) – 1 Found |
| Komatsu, Mari; Saito, Kengo; Miyamoto, Isao; Koike, Kazuyuki; Iyoda, Manabu; Nakashima, Dai; Kasamatsu, Atsushi; Shiiba, Masashi; Tanzawa, Hideki; Uzawa, Katsuhiro. Aberrant GIMAP2 expression affects oral squamous cell carcinoma progression by promoting cell cycle and inhibiting apoptosis. Oncology Letters. 2022;23(2):49. PubMed |