Anti GIMAP1 pAb (ATL-HPA053441)

Atlas Antibodies

Catalog No.:
ATL-HPA053441-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: GTPase, IMAP family member 1
Gene Name: GIMAP1
Alternative Gene Name: HIMAP1, IAN2, IMAP1, IMAP38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090019: 63%, ENSRNOG00000042229: 63%
Entrez Gene ID: 170575
Uniprot ID: Q8WWP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SILGQRRFFSRLGATSVTRACTTGSRRWDKCHVEVVDTPDIFSSQVSKTDPGCEERGHCYLL
Gene Sequence SILGQRRFFSRLGATSVTRACTTGSRRWDKCHVEVVDTPDIFSSQVSKTDPGCEERGHCYLL
Gene ID - Mouse ENSMUSG00000090019
Gene ID - Rat ENSRNOG00000042229
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GIMAP1 pAb (ATL-HPA053441)
Datasheet Anti GIMAP1 pAb (ATL-HPA053441) Datasheet (External Link)
Vendor Page Anti GIMAP1 pAb (ATL-HPA053441) at Atlas Antibodies

Documents & Links for Anti GIMAP1 pAb (ATL-HPA053441)
Datasheet Anti GIMAP1 pAb (ATL-HPA053441) Datasheet (External Link)
Vendor Page Anti GIMAP1 pAb (ATL-HPA053441)