Anti GIGYF2 pAb (ATL-HPA059918)

Atlas Antibodies

Catalog No.:
ATL-HPA059918-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: GRB10 interacting GYF protein 2
Gene Name: GIGYF2
Alternative Gene Name: GYF2, KIAA0642, PARK11, PERQ2, PERQ3, TNRC15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048000: 95%, ENSRNOG00000023577: 95%
Entrez Gene ID: 26058
Uniprot ID: Q6Y7W6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQYAQVLAQQQKAALSSQQQQQLALLLQQFQTLKMRISDQNIIPSVTRSVSVPDTGSIWELQPTASQPTVWEGGSVWDLPL
Gene Sequence QQYAQVLAQQQKAALSSQQQQQLALLLQQFQTLKMRISDQNIIPSVTRSVSVPDTGSIWELQPTASQPTVWEGGSVWDLPL
Gene ID - Mouse ENSMUSG00000048000
Gene ID - Rat ENSRNOG00000023577
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GIGYF2 pAb (ATL-HPA059918)
Datasheet Anti GIGYF2 pAb (ATL-HPA059918) Datasheet (External Link)
Vendor Page Anti GIGYF2 pAb (ATL-HPA059918) at Atlas Antibodies

Documents & Links for Anti GIGYF2 pAb (ATL-HPA059918)
Datasheet Anti GIGYF2 pAb (ATL-HPA059918) Datasheet (External Link)
Vendor Page Anti GIGYF2 pAb (ATL-HPA059918)