Anti GIGYF2 pAb (ATL-HPA050899)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050899-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GIGYF2
Alternative Gene Name: GYF2, KIAA0642, PARK11, PERQ2, PERQ3, TNRC15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048000: 95%, ENSRNOG00000023577: 95%
Entrez Gene ID: 26058
Uniprot ID: Q6Y7W6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QQYAQVLAQQQKAALSSQQQQQLALLLQQFQTLKMRISDQNIIPSVTRSVSVPDTGSIWELQPTASQPTVWEGGSVWDLPL |
Gene Sequence | QQYAQVLAQQQKAALSSQQQQQLALLLQQFQTLKMRISDQNIIPSVTRSVSVPDTGSIWELQPTASQPTVWEGGSVWDLPL |
Gene ID - Mouse | ENSMUSG00000048000 |
Gene ID - Rat | ENSRNOG00000023577 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GIGYF2 pAb (ATL-HPA050899) | |
Datasheet | Anti GIGYF2 pAb (ATL-HPA050899) Datasheet (External Link) |
Vendor Page | Anti GIGYF2 pAb (ATL-HPA050899) at Atlas Antibodies |
Documents & Links for Anti GIGYF2 pAb (ATL-HPA050899) | |
Datasheet | Anti GIGYF2 pAb (ATL-HPA050899) Datasheet (External Link) |
Vendor Page | Anti GIGYF2 pAb (ATL-HPA050899) |