Anti GID8 pAb (ATL-HPA055047)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055047-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GID8
Alternative Gene Name: bA305P22.1, C20orf11, FLJ20602, TWA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027573: 99%, ENSRNOG00000010180: 99%
Entrez Gene ID: 54994
Uniprot ID: Q9NWU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKGVIE |
Gene Sequence | FDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKGVIE |
Gene ID - Mouse | ENSMUSG00000027573 |
Gene ID - Rat | ENSRNOG00000010180 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GID8 pAb (ATL-HPA055047) | |
Datasheet | Anti GID8 pAb (ATL-HPA055047) Datasheet (External Link) |
Vendor Page | Anti GID8 pAb (ATL-HPA055047) at Atlas Antibodies |
Documents & Links for Anti GID8 pAb (ATL-HPA055047) | |
Datasheet | Anti GID8 pAb (ATL-HPA055047) Datasheet (External Link) |
Vendor Page | Anti GID8 pAb (ATL-HPA055047) |