Anti GID8 pAb (ATL-HPA049929)

Atlas Antibodies

Catalog No.:
ATL-HPA049929-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: GID complex subunit 8
Gene Name: GID8
Alternative Gene Name: bA305P22.1, C20orf11, FLJ20602, TWA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027573: 100%, ENSRNOG00000010180: 100%
Entrez Gene ID: 54994
Uniprot ID: Q9NWU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQIQEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTEMERTLALLAF
Gene Sequence GQIQEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECLTEMERTLALLAF
Gene ID - Mouse ENSMUSG00000027573
Gene ID - Rat ENSRNOG00000010180
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GID8 pAb (ATL-HPA049929)
Datasheet Anti GID8 pAb (ATL-HPA049929) Datasheet (External Link)
Vendor Page Anti GID8 pAb (ATL-HPA049929) at Atlas Antibodies

Documents & Links for Anti GID8 pAb (ATL-HPA049929)
Datasheet Anti GID8 pAb (ATL-HPA049929) Datasheet (External Link)
Vendor Page Anti GID8 pAb (ATL-HPA049929)